PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Dca21702.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Caryophyllaceae; Caryophylleae; Dianthus
Family NAC
Protein Properties Length: 160aa    MW: 18094.9 Da    PI: 9.1057
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Dca21702.1genomeDCAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM159.11.7e-49261521128
         NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.kkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkge 98 
                 + pGfrF+Ptdeel+ +yLkkk++g +  + evi++vdi+k+ePwdLp k++ ++++ew+fFs+r kky++g++++ at+ gyWkatgk+++v+s +++
  Dca21702.1  26 MFPGFRFSPTDEELILYYLKKKLDGFDKCV-EVIPQVDICKFEPWDLPaKSIISSDQEWFFFSPRGKKYPNGSQSKSATEIGYWKATGKERAVKS-GSN 122
                 579***********************9777.99***************777788999*************************************9.99* PP

         NAM  99 lvglkktLvfykgrapkgektdWvmheyrl 128
                 ++g+k+tLvf+ grapkge+t+W+mhey +
  Dca21702.1 123 VIGTKRTLVFHIGRAPKGERTEWIMHEYCM 152
                 ****************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019414.58E-5418156IPR003441NAC domain
PROSITE profilePS5100549.10626160IPR003441NAC domain
PfamPF023652.3E-2528151IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 160 aa     Download sequence    Send to blast
MGDVDKEKMK GVVTKEAEIS IAASSMFPGF RFSPTDEELI LYYLKKKLDG FDKCVEVIPQ  60
VDICKFEPWD LPAKSIISSD QEWFFFSPRG KKYPNGSQSK SATEIGYWKA TGKERAVKSG  120
SNVIGTKRTL VFHIGRAPKG ERTEWIMHEY CMIGKGQVIN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4dul_B3e-452515316143NAC domain-containing protein 19
4dul_A3e-452515316143NAC domain-containing protein 19
1ut7_B3e-452515316143NO APICAL MERISTEM PROTEIN
1ut7_A3e-452515316143NO APICAL MERISTEM PROTEIN
1ut4_B3e-452515316143NO APICAL MERISTEM PROTEIN
1ut4_A3e-452515316143NO APICAL MERISTEM PROTEIN
3swp_D3e-452115315146NAC domain-containing protein 19
3swp_C3e-452115315146NAC domain-containing protein 19
3swp_B3e-452115315146NAC domain-containing protein 19
3swp_A3e-452115315146NAC domain-containing protein 19
3swm_D3e-452115315146NAC domain-containing protein 19
3swm_C3e-452115315146NAC domain-containing protein 19
3swm_B3e-452115315146NAC domain-containing protein 19
3swm_A3e-452115315146NAC domain-containing protein 19
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010668790.15e-94PREDICTED: NAC domain-containing protein 89-like isoform X1
RefseqXP_010668797.15e-94PREDICTED: NAC domain-containing protein 89-like isoform X1
RefseqXP_010668802.13e-95PREDICTED: NAC domain-containing protein 89-like isoform X2
SwissprotQ94F584e-75NAC89_ARATH; NAC domain-containing protein 89
TrEMBLA0A0K9RI705e-97A0A0K9RI70_SPIOL; Uncharacterized protein
STRINGGLYMA13G39090.24e-83(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G22290.11e-70NAC domain containing protein 89